BÁO CÁO KHOA HỌC: " ISOLATION AND FUNCTIONAL CHARACTERIZATION OF CE1 BINDING PROTEINS" PPTX

RESEARC H ARTIC LE Open AccessIsolation and functional characterization of CE1binding proteinsSun-ji Lee, Ji Hye Park, Mi Hun Lee, Ji-hyun Yu, Soo Young Kim*AbstractBackground: Abscisic acid (ABA) is a plant hormone that controls seed germination, protective responses tov[r]

novel complete protein coding human cDNAs. GenomeRes 11, 422–435.16 Bannasch D, Mehrle A, Glatting KH, Pepperkok R,Poustka A & Wiemann S (2004) LIFEdb: a database forfunctional genomics experiments integrating informationfrom external sources, and serving as a sample trackingsystem. N[r]

29. Pereira, T.M., Carlstedt-Duke, J., Lechner, M.C. & Gustafsson,J.A. (1998) Identification of a functional glucocorticoid responseelement in the CYP3A1/IGC2 gene. DNA Cell Biol. 17, 39–49.30. Nordeen, S.K. (1988) Luciferase reporter gene vectors for analysisof promoters and[r]

4H12 binds, were proposed to participate in interactionwith MalFG. Interestingly, V114 was found to be locatedin close proximity to MalF only in the presence of ATP,suggesting an ATP-induced conformational change thataffects the relative positions of helix 3 and the EAA loop.The[r]

different insect species. The Bacillus thuringiensis toxins [1],proteins belonging to the lectin family [2], or enzymesinhibitors [3], are in use or being tested, but to date thesemolecules are not adapted to grain protection againstweevils.Therefore, the recent finding of a plan[r]

shows 96% homology to the CHR_tmp.344 while homo-logy in nucleotide sequence was found to be 94%. Otherputative AK genes were significantly different. The results ofSouthern blotting also indicated the AK2 as a single copygene in L. donovani. Investigation of transcription of the AKgene[r]

as mediators of TGF-b signaling during mesoderm pat-terning events. Consistent with a function of HIVEPmembers in regulating TFG-b signaling is the finding thatboth vertebrate and invertebrate proteins can associate withthe Smads [21,23,24]. While we were not able to obtai[r]

ber of lysines. In fact, substitution of three lysines withglutamates in the CK motifs of the a domain modifiedthe metal-binding ability of MT [40].Finally, the mussel MT 10 showed greater thermalstability than the fish protein, probably because of itslonger p[r]

d¼ 4.9 and 9.0 lm for porcine and bovine OBP, respectively). Further-more, OBP functionality, as determined by measuring the binding of thefluorescent ligand 1-aminoanthracene, was partially lost only when incuba-ting HNE levels and exposure time to HNE excee[r]

to consider as hyperthermostable only those proteins thatare stable at temperatures near 100 °C and above? In aque-ous media above 100 °C, hydrophobic interactions andhydrogen bonds are significantly weakened; is this the rea-son why such interactions are not frequently observed asstabi[r]

using the same antibodies against H. pylori bacteriallysate. A single band was detected in the lane contain-ing bacterial lysate confirming the expression ofHpSSB in H. pylori (Fig. 1C). There is a difference inthe migration of the recombinant protein and theendogenous protein be[r]

well as its secretory form (Faulmann et al. 1991). Among the identified staphylococcal and streptococcal immunoglobulin-binding surface proteins, SPA (Grov et al. 1964; Oeding et al. 1964; Verwey 1940) and SPG (Bjorck & Kronvall 1984) have been subjects for substa[r]

leads to the identification of c ontact s ites in th e i nter leukin-6(IL-6). J. Biol. Chem. 272, 23748–23757.51.Kurth,I.,Horsten,U.,Pflanz,S.,Dahmen,H.,Kuster,A.,Grotzinger, J., Heinrich, P.C. & Muller-Newen, G. (1999) Acti-vation of t he s ignal transducer glycoprotein 130 by b[r]

U2B" (1A9N) 8 TIYINNMNDKIKKEELKRSLYAL FSQFGHV VDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFY GKPMRI 81CBP20 (1H2T) 41 TLYVGNLSFYTTEEQIY-ELFSK SGDIKKI IMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLD DRIIRTD 114Y14 (1P27) 74 ILFVTGVHEEATEEDIH-DKFAE YGEIKNI HLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLM GQ[r]

site. (B) Network of hydrogen bonds (dashes) anchoring Man tothe amino acid residues of the monosaccharide-binding site ofMornigaM.Structure of a jacalin-related lectin complexed to mannose A. Rabijns et al.3728 FEBS Journal 272 (2005) 3725–3732 ª 2005 FEBSMoraceae JRL pl[r]

-Ala; TEA, triethylamine.(Received 23 September 2003, accepted 21 October 2003)Eur. J. Biochem. 271, 23–32 (2004) Ó FEBS 2003 doi:10.1046/j.1432-1033.2003.03886.xb-lactam antibiotics. This study also found that deletion ofPBP 3 and PBP 4 individually had only a slight (P >0.05,not stat[r]

2007, accepted 29 June 2007)doi:10.1111/j.1742-4658.2007.05965.xBarnacle attachment to various foreign materials in water is guided by anextracellular multiprotein complex. A 19 kDa cement protein was purifiedfrom the Megabalanus rosa cement, and its cDNA was cloned andsequenced. The gene was[r]

Sc(L559A) mutant at least partly loses its chloride ionand probably also the T2 copper, as the B-value of theT2 copper was rather high. On the basis of the anoma-lous signal, the estimated occupancy of the T2 copperwas about 0.5. T2 copper depletion is known to becommon for lacc[r]

with the ligand, thus illustrating the inherent structuralplasticity of the lipocalin loop region.Indeed, the mechanism of complex formation, atleast with low-molecular-weight ligands, appears to besimilar to the interaction between antibodies and hap-tens, except that the ligan[r]

Two novel Mesocestoides vogae fatty acid bindingproteins – functional and evolutionary implicationsGabriela Alvite, Lucı´aCanclini, Ileana Corvo and Adriana EstevesBiochemistry Section, Cellular and Molecular Biology Department, Faculty of Sciences, University o[r]